Protein Info for CA265_RS23195 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: HIT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF11969: DcpS_C" amino acids 2 to 108 (107 residues), 28.9 bits, see alignment E=1.3e-10 PF01230: HIT" amino acids 10 to 99 (90 residues), 58.7 bits, see alignment E=7.8e-20

Best Hits

Swiss-Prot: 37% identical to YHI1_MYCTO: Uncharacterized HIT-like protein MT0784 (MT0784) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 80% identity to phe:Phep_3809)

Predicted SEED Role

"HIT family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZB04 at UniProt or InterPro

Protein Sequence (132 amino acids)

>CA265_RS23195 HIT family protein (Pedobacter sp. GW460-11-11-14-LB5)
MTIFSKIVAGEIPAHVVAETVEYLAFLDVQPLTAGHVLVIPKIETDYIFDMDEDLYVGLW
MFAKIVAKGVKIAFPCKKVGVSVIGLEVPHAHIHLIPMNNVSDMNFSKEKLKPTNEELAE
AAEKIKQALLEV