Protein Info for CA265_RS22865 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 16 to 293 (278 residues), 97.1 bits, see alignment E=1.5e-31 PF00005: ABC_tran" amino acids 354 to 503 (150 residues), 118.3 bits, see alignment E=4.3e-38

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 76% identity to chu:CHU_2049)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAU0 at UniProt or InterPro

Protein Sequence (583 amino acids)

>CA265_RS22865 ABC transporter ATP-binding protein (Pedobacter sp. GW460-11-11-14-LB5)
MGLLLNYLKHHKWIVALALLLAGINIGFSLLDPYITGRILDRFINKKDSLTYNQYLWGSL
GLIGLAIGAAMVSRIAKNFQDYFTSVIVQKVGAKMYADGLQHSLKLPYQIFEDQRSGETL
GILQKVRLDSEKFITSFISILFVSLIGMIFVIVYSVSVSYKVTLVYFSAIPIISFVSWFL
SRKIKTIQRSIVGETTALAGSTTESLRNIELVKSLGLADQEIDRLNKTTYKILGLELKKV
KYVRSMSFVQGTTVNLVRSTMVLVLLLLIFDNTISAGQYFSFLFYSFFLFGPLQELGNVI
LTWREAEVSLGNFKKILSTPVDKKPENPTSIAKIKDLTFNNVGFKHLTANRNALDNISFK
THHGQTIAFVGPSGSGKSTLVKLLVGLYPAKDGEILYNGIPSNDIDLDALREKIGFVTQD
TQLFSGTIRENLLFVNPNATDEECYKVLNQAACQTLLARADKGLDSLIGEGGVKVSGGEK
QRLSIARALLRQPDILVFDEATSSLDSITEEEITKTIRSVSDLTDHITILIAHRLSTIKH
ADKIYVLEKGNIIEEGRHEELIAQNGLYQAMWRQQIGERVVEA