Protein Info for CA265_RS22705 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: aspartate 1-decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02261: Asp_decarbox
  • amino acids 1 to 114 (114 residues), 171.7 bits, E=2.2e-55
• TIGR00223: aspartate 1-decarboxylase
  • amino acids 1 to 115 (115 residues), 163.6 bits, E=9.5e-53

Best Hits

Swiss-Prot: 72% identical to PAND_PARD8: Aspartate 1-decarboxylase (panD) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01579, aspartate 1-decarboxylase [EC: 4.1.1.11] (inferred from 90% identity to phe:Phep_0135)

MetaCyc: 46% identical to aspartate 1-decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate 1-decarboxylase (EC 4.1.1.11)" in subsystem Coenzyme A Biosynthesis (EC 4.1.1.11)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• β-alanine biosynthesis III (1/1 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pantothenate and CoA biosynthesis
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.11

Sequence Analysis Tools

See A0A1X9ZAR5 at UniProt or InterPro

Protein Sequence (116 amino acids)

>CA265_RS22705 aspartate 1-decarboxylase (Pedobacter sp. GW460-11-11-14-LB5)
MVITILKSKIHRVRVTQAELNYVGSITIDEDLMDAANIIANEKVQIVNNNNGARFETYVI
KGERGTGTICLNGATARLAQLGDILIIMSYGSLPIEEAKKYNPILVFPDDNNHLLK