Protein Info for CA265_RS22565 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 TIGR02274: deoxycytidine triphosphate deaminase" amino acids 2 to 165 (164 residues), 114.7 bits, see alignment E=1.9e-37

Best Hits

Swiss-Prot: 49% identical to DCDB_CLOBB: dCTP deaminase, dUMP-forming (dcd) from Clostridium botulinum (strain Eklund 17B / Type B)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 89% identity to psn:Pedsa_3586)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAV5 at UniProt or InterPro

Protein Sequence (178 amino acids)

>CA265_RS22565 dCTP deaminase (Pedobacter sp. GW460-11-11-14-LB5)
MILSDSRILEEIEKGTIIIEPFKRECLGTNSYDVHLGKYLATYKSRVLDAKAHNEIEHFE
IPKDGYILHPGTLYLGVTVEYTETHGHVPFLEGKSSTGRLGIDIHATAGKGDVGFCNTWT
LEISVAQPVKIYAGMPIGQLIYFVVEGKIETMYNSKGNAKYNNKTTRPVESMMWKNKF