Protein Info for CA265_RS22400 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF05496: RuvB_N" amino acids 11 to 129 (119 residues), 57.2 bits, see alignment E=6.3e-19 PF07728: AAA_5" amino acids 44 to 125 (82 residues), 23.8 bits, see alignment E=1.4e-08 PF00004: AAA" amino acids 44 to 155 (112 residues), 63.2 bits, see alignment E=1.2e-20 PF16193: AAA_assoc_2" amino acids 180 to 253 (74 residues), 80.5 bits, see alignment E=3.2e-26 PF12002: MgsA_C" amino acids 254 to 418 (165 residues), 235.7 bits, see alignment E=9.5e-74

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 90% identity to phe:Phep_0184)

Predicted SEED Role

"ATPase, AAA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAI1 at UniProt or InterPro

Protein Sequence (426 amino acids)

>CA265_RS22400 AAA family ATPase (Pedobacter sp. GW460-11-11-14-LB5)
MQNLPPLAERMRPQNLDEYVGQQHLVGEGAVLRKAIESSQLPSMIFWGPPGVGKTTLAYI
ISQALDRPFFNLSAINSGVKDIREVIDRAAQLKDSFLGLPILFIDEIHRFSKSQQDSLLG
AVERGLVTLIGATTENPSFEVISALLSRCQVYILKSLTETELAGLLETAIKKDSILSAKN
ISIKEHEALIRLSGGDARKLLNVLEIAINGIGGNKIVLTNENVLAHAQQNLALYDKAGEQ
HYDIISAFIKSIRGSDPNAAVYWLARMIEGGEDPLFIARRLLILSSEDIGNANPNALLLA
NNCFTAVNVIGYPEARIILSQCVTYLASSPKSNASYEAINKAQALVKQTGNLPVPLHIRN
APTKLMKNIGYGKDYQYSHGYEGNFSPQEYFPEELSGTKLYDPGKNPAEEKLREKLRQNW
KDKYKY