Protein Info for CA265_RS21975 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: peptidase S41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 52 to 345 (294 residues), 264.3 bits, see alignment E=7.2e-83 PF13180: PDZ_2" amino acids 93 to 168 (76 residues), 40.9 bits, see alignment E=4.4e-14 PF00595: PDZ" amino acids 103 to 160 (58 residues), 31.9 bits, see alignment 2.9e-11 PF17820: PDZ_6" amino acids 108 to 162 (55 residues), 43.7 bits, see alignment 3.9e-15 PF03572: Peptidase_S41" amino acids 191 to 345 (155 residues), 171.8 bits, see alignment E=1.9e-54

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 69% identity to phe:Phep_4121)

Predicted SEED Role

"C-terminal processing peptidase, tail-specific protease( EC:3.4.21.102 )"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZA89 at UniProt or InterPro

Protein Sequence (563 amino acids)

>CA265_RS21975 peptidase S41 (Pedobacter sp. GW460-11-11-14-LB5)
MKKLKYGLLAAGFGLAVLSFSFKEDLFLVSKNLDIFASLYKEININYVDDTNAPQLMKTG
IDAMLDSLDPYTEYVPESEIEDYKLKYVSTQYGGIGASTVFIDGKLFINDVSEGYPANKS
EVKAGDQVVSINGIAVKGKDRQEISQLLRGPKGTPVDLLVIRDGKEITKKLVRDEIKQPN
VSYSGMVGDGIGYIKLDKFLENSGQEVKDALLAIQKENPKGVVLDLRNNGGGILQEAVKI
VNLFVNKDQLIVTQKGKNVEKNIAYKTLLTPVSTSVPLVVLVNGNSASASEIVAGSLQDL
DRAIVIGQRSYGKGLVQQTFNLPYNSLVKVTVAKYYTPSGRCIQKLDYAHKNADGVAERF
ADSTMVMYQTKAGRNVYSGNGVYPDIVVDAKKLSPITISMINKNLFFNYANQYRKEKPSL
ASAKTFQLSDADYATFSGSLADKDLAYQSRTERLLSDLRLEAEKENKSAEVKTDLENLKY
KLTSSKKTDLVSHKAEIKRVLETQIVSRYFYEKGRIEQSFQYDKELAAAKNLFTNQSQIL
AILKGDGNYKVIGKPTKATASID