Protein Info for CA265_RS21880 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: futalosine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03664: futalosine hydrolase
  • amino acids 3 to 202 (200 residues), 179.5 bits, E=4e-57
• PF01048: PNP_UDP_1
  • amino acids 37 to 195 (159 residues), 43.1 bits, E=1.7e-15

Best Hits

KEGG orthology group: K01243, S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [EC: 3.2.2.9] (inferred from 60% identity to phe:Phep_4151)

Predicted SEED Role

"Menaquinone via futalosine step 2" in subsystem Menaquinone Biosynthesis via Futalosine

MetaCyc Pathways

• S-methyl-5'-thioadenosine degradation IV (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• autoinducer AI-2 biosynthesis II (Vibrio) (4/6 steps found)
• S-methyl-5'-thioadenosine degradation I (1/2 steps found)
• autoinducer AI-2 biosynthesis I (3/5 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• 5'-deoxyadenosine degradation II (1/4 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.9

Sequence Analysis Tools

See A0A1X9ZBA7 at UniProt or InterPro

Protein Sequence (207 amino acids)

>CA265_RS21880 futalosine hydrolase (Pedobacter sp. GW460-11-11-14-LB5)
MKTLVVAATKAELAFFYQHFNLPDGDFVESKNFDLLITGVGMVATAFALGKHLSSKYDLV
VNFGIAGSFDRNLALGTVLHITEDTFAELGAENGDEFLTISDLGFGENHYTSKTHQSVSL
PIAKGITVNCVTGSEKSIKNLIKRLNPTTESMEGAAVFYACKQLNVDCLQIRSISNYVEP
RNKDNWKIGLAIKNLNDWAIAFVGEMN