Protein Info for CA265_RS21795 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: magnesium transporter MgtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details PF02308: MgtC" amino acids 20 to 139 (120 residues), 131.8 bits, see alignment E=8.4e-43

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 73% identity to phe:Phep_0240)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZA53 at UniProt or InterPro

Protein Sequence (219 amino acids)

>CA265_RS21795 magnesium transporter MgtC (Pedobacter sp. GW460-11-11-14-LB5)
MNEIIDQNHFITQSEINKFLLATLLCGIIGAEREYRSKSAGLKTMMMIGLGATLFTILSI
KIGPTSQDRIASNIVTGIGFLGAGVIFKEENRVKGLTTACIIWIVAAIGMAVGSGYYEQA
IGVTIVVLLALIIFPFLEEIGDRRFTKRVYRIVKKQHTHGNLESYEEVFRESKLKPQRGK
HQLVDNIITGNWTATGTPQNHQKFVERMLKDDDIIEFDF