Protein Info for CA265_RS21700 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details PF00512: HisKA" amino acids 116 to 182 (67 residues), 56.4 bits, see alignment E=2.5e-19 PF02518: HATPase_c" amino acids 230 to 339 (110 residues), 98.2 bits, see alignment E=3.9e-32

Best Hits

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 80% identity to phe:Phep_0192)

Predicted SEED Role

"Sensory transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZA29 at UniProt or InterPro

Protein Sequence (341 amino acids)

>CA265_RS21700 two-component sensor histidine kinase (Pedobacter sp. GW460-11-11-14-LB5)
MKLSVLVLFTALAVGLSIGMVNFYFQHSLYYMAISFGVSFLCSFLVFYYLLEKYIYTKIK
LIYKLIHNLKLGKDLKDALGEYVSSDPINDVEQEVKEWAGAKKKEIDLLKKQEQFRREFL
SNVSHEFKTPLFAIQGYIETLQDCLVDDPDQAVLFLKKAENNVERLSYLINDLDVISKLE
TGESPINYQKFDFVQLAKEVMENLEDRAEAKNIKLFFKDKYTAITLVSADREKIRQVLIN
LMVNSIKYGIDGGETAIKIFELHDQVLIEVTDNGIGIEEKHLLRLFERFYRIDTHRAREV
GGTGLGLAIVKHILEAHQQTISVRSTPGIGTTFAFTLQKGG