Protein Info for CA265_RS21595 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR00369: uncharacterized domain 1" amino acids 21 to 134 (114 residues), 131.1 bits, see alignment E=1e-42 PF03061: 4HBT" amino acids 50 to 124 (75 residues), 59.8 bits, see alignment E=1.4e-20

Best Hits

Swiss-Prot: 54% identical to MENI_ECOLI: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (menI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 62% identity to psn:Pedsa_2924)

MetaCyc: 54% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZA11 at UniProt or InterPro

Protein Sequence (140 amino acids)

>CA265_RS21595 esterase (Pedobacter sp. GW460-11-11-14-LB5)
MWFKNFTVDELNNRPKNHLGALLDIRFTEIGEDFIIGTMPVDERTHQPAGILHGGASVVL
AETLGSIASYMCIDPEKYVAVGLEVNANHLRPVKSGLVKGICKPLHIGAKTQVWEIKIYD
ERGKMNCISRLTVAIINKPQ