Protein Info for CA265_RS21580 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: QacE family quaternary ammonium compound efflux SMR transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 1 to 93 (93 residues), 98.8 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 44% identical to GDND_BACLD: Probable guanidinium efflux system subunit GdnD (gdnD) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: K11741, quaternary ammonium compound-resistance protein SugE (inferred from 86% identity to phe:Phep_4255)

MetaCyc: 46% identical to guanidinium exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-368; TRANS-RXN-369

Predicted SEED Role

"Quaternary ammonium compound-resistance protein SugE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBD0 at UniProt or InterPro

Protein Sequence (106 amino acids)

>CA265_RS21580 QacE family quaternary ammonium compound efflux SMR transporter (Pedobacter sp. GW460-11-11-14-LB5)
MNWIILIIAGLFEVGFTTCLKLSNNFSNIKWSTAFFVCIILSFLLLNKATQTLPMGTAYA
VWTGIGAVGTVIIGIFYFNEPATFWRIFFICTLIGSIAGLKFFASH