Protein Info for CA265_RS21460 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 5-formyltetrahydrofolate cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01812: 5-FTHF_cyc-lig
  • amino acids 3 to 180 (178 residues), 99.6 bits, E=1e-32
• TIGR02727: 5-formyltetrahydrofolate cyclo-ligase
  • amino acids 3 to 180 (178 residues), 121.3 bits, E=2.2e-39

Best Hits

KEGG orthology group: K01934, 5-formyltetrahydrofolate cyclo-ligase [EC: 6.3.3.2] (inferred from 57% identity to phe:Phep_4275)

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• folate transformations I (8/13 steps found)

KEGG Metabolic Maps

• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

See A0A1X9ZB96 at UniProt or InterPro

Protein Sequence (186 amino acids)

>CA265_RS21460 5-formyltetrahydrofolate cyclo-ligase (Pedobacter sp. GW460-11-11-14-LB5)
MLKAEIRKQALKDRLLLSDAEYENLNEALLNEFKTLDFSQIKTLHIFLPIIEKKEPNTFL
LIEWLNKNHPEIKIIVPKADFETALMTNHEYLGVNDLKKNLYNILEPQKGNLHEGEVDLV
VVPLLAFDRQGYRVGYGKGFYDRFLQHINAQKIGLSLYPAIEKIDDVNEHDIRLDFCITP
TEIINF