Protein Info for CA265_RS21000 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ribosome silencing factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00090: ribosome silencing factor" amino acids 15 to 113 (99 residues), 113 bits, see alignment E=3.1e-37 PF02410: RsfS" amino acids 17 to 113 (97 residues), 114.5 bits, see alignment E=1.1e-37

Best Hits

KEGG orthology group: K09710, ribosome-associated protein (inferred from 79% identity to phe:Phep_0031)

Predicted SEED Role

"Ribosomal silencing factor RsfA (former Iojap)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9P8 at UniProt or InterPro

Protein Sequence (124 amino acids)

>CA265_RS21000 ribosome silencing factor (Pedobacter sp. GW460-11-11-14-LB5)
MVKKKIVALSTYLSELAVHGIQEKKGEDIVRLDLRNIHTSVADYFIIASANSGTQVKAIA
DSVEKEIYKATQADPRHKEGFESADWIILDYFDVVVHIFKTEKRHFYGIEELWGDAESTN
YQSA