Protein Info for CA265_RS20980 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 6-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00365: PFK" amino acids 6 to 280 (275 residues), 368.9 bits, see alignment E=1.7e-114 TIGR02482: 6-phosphofructokinase" amino acids 7 to 305 (299 residues), 407.4 bits, see alignment E=1.6e-126

Best Hits

Swiss-Prot: 55% identical to PFKA_CYTH3: ATP-dependent 6-phosphofructokinase (pfkA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 79% identity to phe:Phep_0033)

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.11

Use Curated BLAST to search for 2.7.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCT0 at UniProt or InterPro

Protein Sequence (327 amino acids)

>CA265_RS20980 6-phosphofructokinase (Pedobacter sp. GW460-11-11-14-LB5)
MNKIKNIGVLTSGGDSPGMNAAIRAVVRGSIYYDIEVTGFMRGYEGLINNDFIPMDRKSV
ANIIQRGGTILKTARSEAFKTVEGRKKAYENLKANGIDALVVIGGDGTFTGANIFSKEFD
FPIVGLPGTIDNDLAGTDFTIGYDSAINTVIDAVDKIRDTAESHDRLFIVEVMGRDSGLI
ALRSGIGVGAEAIMIPEANMNADDILHKLEHSRKDKASKIIIVAEGDDTGGAFKVGEILQ
AKYPHYDTKVSVLGHIQRGGKPTCMDRVLASRLGVAAVEGLINGESGVMAGQINREIVFT
PFDHAIKHINAEKVSSKWLKLIDILSF