Protein Info for CA265_RS20905 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: phosphatidylserine decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to PSD_CYTH3: Phosphatidylserine decarboxylase proenzyme (psd) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 85% identity to phe:Phep_0043)Predicted SEED Role
"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)
MetaCyc Pathways
- superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
- phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
- cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (2/4 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
- superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.1.65
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9ZAR6 at UniProt or InterPro
Protein Sequence (219 amino acids)
>CA265_RS20905 phosphatidylserine decarboxylase (Pedobacter sp. GW460-11-11-14-LB5) MTIHKEGYTTIALSILFIFVINAVVDYKYHDITWLRWFIYIFSAALFIIVLQFFRNPSRS FSSGENLVICPADGKVVVIEETEEGEYFKDKRLQVSIFMSPINVHINRNPISGVVKFFKY HPGKYLAAWNPKSSTENERTTTVVEHKNGTPVLFRQIAGALARRIVWYVKEGDQVVQAEQ FGFIKFGSRVDVFLPVGTKVNVELNQVVKGGITTLATLS