Protein Info for CA265_RS20545 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 2-amino-3-ketobutyrate CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF00155: Aminotran_1_2" amino acids 67 to 405 (339 residues), 164.4 bits, see alignment E=4.6e-52

Best Hits

Swiss-Prot: 42% identical to BIOF_THEPX: 8-amino-7-oxononanoate synthase (bioF) from Thermoanaerobacter sp. (strain X514)

KEGG orthology group: K00639, glycine C-acetyltransferase [EC: 2.3.1.29] (inferred from 51% identity to phe:Phep_2862)

Predicted SEED Role

"2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29)" in subsystem Glycine Biosynthesis or Glycine and Serine Utilization (EC 2.3.1.29)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.29

Use Curated BLAST to search for 2.3.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAQ5 at UniProt or InterPro

Protein Sequence (420 amino acids)

>CA265_RS20545 2-amino-3-ketobutyrate CoA ligase (Pedobacter sp. GW460-11-11-14-LB5)
MDINFEKASFKDFENIEGMDAYQRARYFAEYLEYLKSRGHLNYRMETMSGCGPEVELDIA
GYGGKKKYVSLVSNDYLGFTQHDLVKKAAIDGIKKFGTGAGASPAIGGHFSFHEMLEQKI
AAFFGREAAITYTTGYTANSASLLCLLKKEDMAILDMAVHASVYEGCMNTNIKMFLHNNM
DALERALRESRDTHRTRIVVVDGVYSQDGDLAPLDKILELTHFYGAYLMVDDAHGIGVLG
RTGRGLIQDYDLLDKVDIISGTFSKTFGHVGGYVVASAELIQFLKYQSRQHLFSVTASPA
SMAILKAIDLIDEEPEWQDMLWENITYFQDGLKGLGLDIGTTASGIVPVKIRDIPKTLEV
GRLLLRAGVYANPIMYPAVAKKDSRIRMSLMATHTRPQLDKVLNAFSDIAKKLQLGSQYQ