Protein Info for CA265_RS20375 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF01596: Methyltransf_3" amino acids 19 to 211 (193 residues), 168.5 bits, see alignment E=3.7e-53 PF01135: PCMT" amino acids 43 to 161 (119 residues), 28.8 bits, see alignment E=3.2e-10 PF01209: Ubie_methyltran" amino acids 55 to 160 (106 residues), 21.1 bits, see alignment E=5.3e-08 PF13847: Methyltransf_31" amino acids 58 to 180 (123 residues), 33.8 bits, see alignment E=8.2e-12 PF13649: Methyltransf_25" amino acids 61 to 156 (96 residues), 27.3 bits, see alignment E=1.5e-09 PF13578: Methyltransf_24" amino acids 62 to 163 (102 residues), 56.4 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: None (inferred from 81% identity to phe:Phep_0073)

Predicted SEED Role

"O-methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9E3 at UniProt or InterPro

Protein Sequence (212 amino acids)

>CA265_RS20375 methyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MSLINDDLQDLLIAYCEPESELLQQIDRETNLKVLMPRMLSGHYQGRVLSMLSKMISPKR
ILEIGTFTGYATLCLAEGLTSDGLLYTLDINEELEDMVRHNFAQSAFNHQINYILGDATH
TIAALDEVFDIVFIDADKKNNGTYYDLIFDRVRPGGIIIVDNVLWSGKVLQEKQDKDTRN
ITSFNDKIAADERVEKLILPVRDGLFLIRKKA