Protein Info for CA265_RS20190 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: thiamine biosynthesis protein ThiF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00899: ThiF" amino acids 10 to 239 (230 residues), 245.2 bits, see alignment E=4.5e-77 PF00581: Rhodanese" amino acids 265 to 344 (80 residues), 39.5 bits, see alignment E=6.3e-14

Best Hits

KEGG orthology group: None (inferred from 49% identity to sli:Slin_6576)

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9A2 at UniProt or InterPro

Protein Sequence (345 amino acids)

>CA265_RS20190 thiamine biosynthesis protein ThiF (Pedobacter sp. GW460-11-11-14-LB5)
MLVKEELSRYNRQMILPELGLAGQEKLKAAKVLVIGAGGLGCPILQYLAAAGVGEIGIID
DDVVELSNLHRQILYNHTDIGQPKAKVAAEKLAVLNPNIRLKVYHERFTAASAAKICRDY
DLIIDCSDNFSTRYLVNDTCVALGKILLFGSILQFEGQVAVFNYQGSANYRDLYPTPPTE
NLNCAEGGVIGILPGIVGLYMANEALKLICGIGETLSGKLMTINALNNTVLVFKIAAEKS
ADPAKPAATKNDKAIPEINKTTLNNWLETQADDVFLIDVRESYEHEEDNIGGINLPLYEL
TESLAAIPKNKNVVFYCQTGQRSKMAVQLLTGLYQGEVYSLKNGQ