Protein Info for CA265_RS19900 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: pectin esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01095: Pectinesterase
  • amino acids 24 to 300 (277 residues), 256.5 bits, E=1.2e-80

Best Hits

KEGG orthology group: K01051, pectinesterase [EC: 3.1.1.11] (inferred from 72% identity to phe:Phep_1157)

Predicted SEED Role

"rhamnogalacturonan acetylesterase" in subsystem L-rhamnose utilization

MetaCyc Pathways

• pectin degradation II (3/5 steps found)
• pectin degradation I (1/3 steps found)

KEGG Metabolic Maps

• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.11

Sequence Analysis Tools

See A0A1X9Z9Z0 at UniProt or InterPro

Protein Sequence (318 amino acids)

>CA265_RS19900 pectin esterase (Pedobacter sp. GW460-11-11-14-LB5)
MKAIILFFLVAISLTANALETKADFVVAADGSGNFKTVQEAINAVPDFRNKITVILIKKG
IYKEKLILAASKKNVRFIGESVNETILTYDDYAQKKNVFGEEKGTSGSSSFYIYGEGFSA
ENITFENSSGPVGQAVAVWAGGDKLIFTNCRFLGFQDTLYTYGGNNRQYYKNCYIEGTVD
FIFGASTAWFESCTIFCKKAGYITAASTADTTKFGYVLNKCKIKGDAPANSFYLGRPWRP
YAKVAYLNCELPDLIRPEGWNNWGKESNEKTAYYAEYKSSGKGADPEKRANWSHQLTDNE
YKTYILENVFRGWDPEVK