Protein Info for CA265_RS19860 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14)
Rationale: Specifically important for utilizing D-Galacturonic Acid monohydrate. Automated validation from mutant phenotype: the predicted function (KDPGALDOL-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01081: Aldolase
  • amino acids 14 to 204 (191 residues), 95.4 bits, E=1.6e-31

Best Hits

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 60% identity to psn:Pedsa_2717)

Predicted SEED Role

"4-Hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16) @ 2-dehydro-3-deoxyphosphogluconate aldolase (EC 4.1.2.14)" (EC 4.1.2.14, EC 4.1.3.16)

MetaCyc Pathways

• superpathway of hexuronide and hexuronate degradation (10/10 steps found)
• superpathway of β-D-glucuronosides degradation (7/7 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
• D-galacturonate degradation I (5/5 steps found)
• D-fructuronate degradation (4/4 steps found)
• Entner-Doudoroff pathway I (7/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• trans-4-hydroxy-L-proline degradation I (4/5 steps found)
• Entner-Doudoroff shunt (1/2 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• D-glucosaminate degradation (1/3 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (18/31 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glyoxylate and dicarboxylate metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.3.16

Sequence Analysis Tools

See A0A1X9ZCR8 at UniProt or InterPro

Protein Sequence (219 amino acids)

>CA265_RS19860 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (Pedobacter sp. GW460-11-11-14-LB5)
MSNKHKILDAILEQGMLPLFYQDSESGSVEILRTLYKAGVRVFEYTNRGKSALPNFKKLK
EIRDAEMPDLYLGIGTIKTPADANAFIEAGTDFIVAPIVNPAVAEIANKIGMLWIPGCMT
PTEISVAQEHKAMLIKIFPANILGPEFISSIKDLFAGQLFMPTGGVEINADNLKTWFKSG
VCAVGMGSKLISKDVMSKGLYEELFDNTKLALDLIQQSK