Protein Info for CA265_RS19790 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DUF4153 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 106 (18 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details PF13687: DUF4153" amino acids 62 to 388 (327 residues), 104.4 bits, see alignment E=4.1e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9X1 at UniProt or InterPro

Protein Sequence (603 amino acids)

>CA265_RS19790 DUF4153 domain-containing protein (Pedobacter sp. GW460-11-11-14-LB5)
MKLPSLQQLYLGFVNVIKRFPLQIIFAVAATLCWCYYIHISDYRNYSEQNENLKDHLIKA
VAILNLALTLVLALDLISERNQYSLKKKWLLRLGGLLTGVLLYFSLDPSNYSADLYRIFL
FAFAFHLLVAFAPFIGQEKVNGFWQFNKALFLRFLTSALYSAVLFAGLAIALVAIDGLFN
ADIKWQTYMTLFAIISAGFNTTFFLAGIPTDYKLLEEDHSYPKGLKIFAQFVLIPLVTIY
LAILLVYEIKIAALWELPKGLVSSLILGYAVFGILSLLLVYPVKETDGNSWIKLFSRFFY
VMMIPLVVLLLLAVWKRVGHYGITESRYVLTALALWLAGITIYFLFSKKQNIKVIPISLC
IISLLATYGPQSAFSVSKYSQLSRLKRIMNSKKKDDIREKPAVIRYLVYTHGLKTLQPFT
KKDLSKIEERIDGTNNYRYSMRMNKVDTALAIFKVKGVLEYDPGVSITLQNNENQVLSVK
GYDYLIELNGYPEKKVTRLYGTDLTTNKINSKISLLVNNQEALYIDLKEVFGQARKAYEN
GALKASGKKQEYLYPAKLMSVSKNINGYNYTIVVTSLQGTYYENDHDANLWFEAKSYLLI
KKL