Protein Info for CA265_RS19720 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sodium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details amino acids 449 to 468 (20 residues), see Phobius details amino acids 498 to 515 (18 residues), see Phobius details amino acids 536 to 557 (22 residues), see Phobius details PF00474: SSF" amino acids 42 to 457 (416 residues), 204.4 bits, see alignment E=1.4e-64 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 42 to 457 (416 residues), 319.6 bits, see alignment E=1.7e-99

Best Hits

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 78% identity to lby:Lbys_2944)

Predicted SEED Role

"putative sodium/hexose cotransport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9C5 at UniProt or InterPro

Protein Sequence (558 amino acids)

>CA265_RS19720 sodium transporter (Pedobacter sp. GW460-11-11-14-LB5)
MKNNLLDTKDYIVFAIYFVIVAAYGLYIYNKKKSASTGSKDYFLAEGSLTWWAIGASLIA
SNISAEQFIGMSGSGFKMGLAIATYEWMAALTLVIVAVFFIPVYLKNKIATMPQFLHQRY
NGTVAMIMAVFWLLLYVVVNLTSILYLGALAVSSISGFDLTFCMYAIAAFAIVITLGGMK
VIGYTDVIQVFFLILGGLATTYLALNLVSTHYGTSGIFEGYSLMTSKASEHFHMILKPDN
ENYIDLPGLSVLVGGMWIVNLNYWGCNQYITQRALGADLKTARGGILFAAFLKLLMPIIV
VLPGIAAYVLYKDGAFQSEMLQDGSVNPDRAYPVLLNLLPAGLKGLSFAALTAAVVASLA
GKANSIATIFTLDIYKKVLKTDASEKNLVFTGKIAVVVAMVLGVVIAPYLGIDKKGGFQY
IQEYTGFVSPGIFAMFILGFFWKRATSNAALFATVGGFGLSLLLKVLPTWTDLSWLSGMG
FSVKNGVGVYEIPFLDRMGFVFVFCVIGMVIISLFENRNGVNPKGLEIDSKMFKTTTGFA
VGSLIIIGLLVALYSVYW