Protein Info for CA265_RS19615 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF13483: Lactamase_B_3" amino acids 4 to 189 (186 residues), 81.4 bits, see alignment E=1.1e-26 PF00753: Lactamase_B" amino acids 7 to 209 (203 residues), 55.7 bits, see alignment E=9.9e-19 PF12706: Lactamase_B_2" amino acids 20 to 190 (171 residues), 81.4 bits, see alignment E=1e-26

Best Hits

Swiss-Prot: 49% identical to Y2786_FLAJ1: UPF0173 metal-dependent hydrolase Fjoh_2786 (Fjoh_2786) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: None (inferred from 76% identity to phe:Phep_4213)

Predicted SEED Role

"beta-lactamase domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9B1 at UniProt or InterPro

Protein Sequence (225 amino acids)

>CA265_RS19615 metal-dependent hydrolase (Pedobacter sp. GW460-11-11-14-LB5)
MKYTYYGQSCFLLEAAGKKLLFDPFISHNPLAKNIDIKTIEADYILVSHGHGDHVADLVA
LARQTQATVIAMPEVTDWASKQGVEKVHGMNFGKFTFDWGAVRMVPATHSSGLPDGSYGG
NPAGFVLEVEGKQIYFAGDTGLTIEMKVLADIYNLDYAILPIGGNYTMDVDDALVATKYF
DCDKVIGVHYNTFPVIEIDTKAALDKFKRENKTLLLPEIGETISL