Protein Info for CA265_RS19430 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 680 TIGR00631: excinuclease ABC subunit B" amino acids 2 to 670 (669 residues), 997.1 bits, see alignment E=1.7e-304 PF04851: ResIII" amino acids 10 to 85 (76 residues), 40.1 bits, see alignment E=9.3e-14 PF17757: UvrB_inter" amino acids 160 to 247 (88 residues), 107.3 bits, see alignment E=8.4e-35 PF00271: Helicase_C" amino acids 432 to 543 (112 residues), 74.4 bits, see alignment E=2.1e-24 PF12344: UvrB" amino acids 550 to 590 (41 residues), 74.1 bits, see alignment 1.5e-24 PF02151: UVR" amino acids 640 to 672 (33 residues), 29 bits, see alignment (E = 1.7e-10)

Best Hits

Swiss-Prot: 64% identical to UVRB_PELCD: UvrABC system protein B (uvrB) from Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 86% identity to phe:Phep_4036)

MetaCyc: 61% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9P5 at UniProt or InterPro

Protein Sequence (680 amino acids)

>CA265_RS19430 excinuclease ABC subunit B (Pedobacter sp. GW460-11-11-14-LB5)
MKFKITSEYQPTGDQPNAIKQLVDGVNANEHYQTLLGVTGSGKTFTVANVIEQTQKPTLI
LSHNKTLAAQLYGEFKNFFPENSVNYFVSYYDYYQPEAFIASSNTYIEKDLSINEEIEKL
RLRTTSSLMSGRRDIIVVSSISCIYGMGNPEDFSRMVFRFGVGLRISRNAFLHSLVEILY
SRTTTDFKRGTFRVKGDTVDIFPAYLDHAYRISFFGDDIEELSSIDPVSGKTIEKLEDMA
IYPANLFVTPKDRFNSSIWGIQEELEIRKNQLIADRHLLEAKRLEERTNFDIEMMKELGY
CSGIENYSRFFDGRQPGMRPFCLLDYFPEDYLMVIDESHVTVPQIRAMYGGDRSRKLSLV
EYGFRLPAALDNRPLNFNEFEALAPQTIYVSATPAEYELEKSEGVVVEQVIRPTGLLDPV
IEIRPAINQVDDLLDEIDITIKDGGRILVTTLTKRMAEELTKYLDRLNIKTRYIHSEIKT
LERVEILRGLRLGEFDVLVGINLLREGLDLPEVTLVAILDADKEGFLRSEKSLIQTIGRA
ARNDKGRVIMYADGITDSMEKTISETNRRRDIQIAYNLENGITPKTVGKSREAILEQTSV
LDFSQKASDNKARAYVENAEISIAADPIVQYMGKAELQRAIDTTRKDMQKAAKDMDFLQA
AKLRDEMFALEKMFNEKFGK