Protein Info for CA265_RS19380 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: beta-carotene 15,15'-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 95 to 123 (29 residues), see Phobius details amino acids 144 to 171 (28 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details PF19992: DUF6427" amino acids 58 to 325 (268 residues), 46.8 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 71% identity to phe:Phep_4030)

Predicted SEED Role

"FIG00908734: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9N5 at UniProt or InterPro

Protein Sequence (326 amino acids)

>CA265_RS19380 beta-carotene 15,15'-monooxygenase (Pedobacter sp. GW460-11-11-14-LB5)
MINQFRKLNPINLVFLLAYTFFLRIAIFHETHDKLNFDFLEPFARLLINIDLDNAFTPYT
NIFIAALLVYVQALIFNRVVNNHNLLTKPSFLPGLMFITGTSLFMPFMILSPALLCNFLL
IWIIDKFLKLGKSANSITTVFDIGMIIGVGTLIYFPFMTMLLMIFLALLLFRSFNWREWV
AGLIGFITVFFFLAVFYYWKDNLSSFYQIWKPLGNKFPSVFKINYNDYLVLIPVTVIIIL
ASLQLRENFFRSFISTRKSFQLLFFMFIISAASFYLKPDFRTWHFLLCVPPGSVLLAYYF
SNAKKRWFYETLFVLFVLSIQYFLFV