Protein Info for CA265_RS18950 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF13404: HTH_AsnC-type" amino acids 11 to 52 (42 residues), 40.3 bits, see alignment E=3.4e-14 PF13412: HTH_24" amino acids 12 to 58 (47 residues), 44.5 bits, see alignment E=1.4e-15 PF01037: AsnC_trans_reg" amino acids 78 to 149 (72 residues), 64 bits, see alignment E=1.4e-21

Best Hits

Swiss-Prot: 48% identical to ASNC_HAEIN: Regulatory protein AsnC (asnC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03718, Lrp/AsnC family transcriptional regulator, regulator for asnA, asnC and gidA (inferred from 93% identity to phe:Phep_4176)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9C4 at UniProt or InterPro

Protein Sequence (158 amino acids)

>CA265_RS18950 transcriptional regulator (Pedobacter sp. GW460-11-11-14-LB5)
MLKKDNSNLEIDNLDIDILKQLMQDATKPYTEIAKDLIVSGGTIHVRMKKLQEMGIIKGS
HLIIDPQKAGYDICAFLGIYLEKGIQYKDAVAQLSKIKEVVELHYTTGAYSMFAKIICRD
TNHLRHVLNEEIQAVNGIQRTETLISLEESIKRQIELG