Protein Info for CA265_RS18880 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: RNA-binding transcriptional accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 PF09371: Tex_N" amino acids 8 to 191 (184 residues), 235.1 bits, see alignment E=1.5e-73 PF16921: Tex_YqgF" amino acids 315 to 436 (122 residues), 161.1 bits, see alignment E=5.1e-51 PF14635: HHH_7" amino acids 450 to 542 (93 residues), 33.3 bits, see alignment E=1.6e-11 PF12836: HHH_3" amino acids 477 to 541 (65 residues), 97.2 bits, see alignment E=1.5e-31 PF17674: HHH_9" amino acids 547 to 616 (70 residues), 86.5 bits, see alignment E=5.4e-28 PF00575: S1" amino acids 635 to 706 (72 residues), 78.6 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 77% identity to phe:Phep_4177)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z8P0 at UniProt or InterPro

Protein Sequence (763 amino acids)

>CA265_RS18880 RNA-binding transcriptional accessory protein (Pedobacter sp. GW460-11-11-14-LB5)
MLTHHKIIAAELKVAEKQVTATINLLDEGATVPFISRYRKEATGSLDEVEVAAIRDRVLQ
LRDLDKRREAILKSMTELGKLTPELEKKINEAETISLLEDIYLPFKPKRKTRASVAKEKG
LEPLALQIFEQHAFDLEASADKFIDAEKGVNSLDEALAGARDIIAEMISENVEARTKMRT
YFQEKASFKSEVIKGKEEEGIKYKDYFEWNEPVKTAASHRVLAMRRGEKELILRLDALPP
AEDAIAILENQFILGNNAASKQVQQALEDGYKRLLEPAMETELRVFTKQKADEEAIRVFA
ENARQLLLAAPMGQKNVLAIDPGFRTGCKVVCLDKQGQLLENTAIYPHTGQGNVKNAEFT
IQQLCEKHNVEAIAIGNGTAGRETEAFVRALNLPHITIVMVNESGASIYSASEVAREEFP
TQDITVRGAVSIGRRLMDPLAELVKIDPKSIGVGQYQHDVDQNKLQASLDDTVISAVNAV
GVELNTASKQILAYVSGLGPTLAQNIVDYRNTHGAFKNRESLKKVPRLGDKAYEQAAGFL
RIRNAENVLDTSGVHPERYAVVDKMAKDLGTTVSALMKDTQLQKQIKPQQYVTDEIGLPT
LTDILKELAKPGRDPREQFEAFSFTDGVNEISDLRVGMKLPGIVTNITNFGAFVDIGVHQ
DGLVHTSQLANRFVANPNDVVKVHQKVEVTVMEVDAARKRISLSMKTEVSPKSEVRSRES
KEHKPKQEYKPNNSKPIFKPRNEPKDADGDLQEKLAKLKGMFK