Protein Info for CA265_RS18740 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00224: PK
  • amino acids 7 to 324 (318 residues), 404.1 bits, E=4.5e-125
• TIGR01064: pyruvate kinase
  • amino acids 7 to 474 (468 residues), 541.1 bits, E=9.7e-167
• PF02887: PK_C
  • amino acids 360 to 472 (113 residues), 98.1 bits, E=3.7e-32

Best Hits

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 87% identity to phe:Phep_4190)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• homolactic fermentation (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• Entner-Doudoroff pathway I (7/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• heterolactic fermentation (13/18 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)
• glycerol degradation to butanol (9/16 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (15/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

See A0A1X9Z987 at UniProt or InterPro

Protein Sequence (476 amino acids)

>CA265_RS18740 pyruvate kinase (Pedobacter sp. GW460-11-11-14-LB5)
MKPFHSRTKIVATLGPASAKPDVLYSMFNAGLDVCRLNFSHGSQADHQAVLDTIRDLNKK
YDYNVGILADLQGPKIRIGLVKEGGINLINGKTTVITTTECIGNEERIYITYQNFPQDVQ
AGEIILLDDGKLQMKVISTNLKDEVVCEVVHGGILTSRKGVNLPNTKVSIPSLTPEDREN
LEFVLENDVEWIGLSFVRKAEDIIELKKIIAERGKTARVIAKIEKPEAIANIDEIIAATD
GIMVARGDLGVECPMEEVPLLQKMIVAKCRAASKPVIVATQMLESMITTPRPTRAEVNDV
ANSVLDGADAVMLSGETSVGEFPLIVIETMQKIIQNIEQNNYPFNPDKFLKPKSPSFLSD
AICDSACFLAKQTNAVGIVSMTLSGYTAFEISSHRPEALTFIFTSNRALLNAVSLLWGVR
GFYYDKWESTDNTIIEVNEFLKSKKLVKQGDIVINTAAIPMEAKGKTNMLKITVID