Protein Info for CA265_RS18335 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00581: Rhodanese" amino acids 12 to 123 (112 residues), 45.2 bits, see alignment E=5.7e-16 amino acids 157 to 270 (114 residues), 45.8 bits, see alignment E=3.5e-16

Best Hits

KEGG orthology group: K01011, thiosulfate/3-mercaptopyruvate sulfurtransferase [EC: 2.8.1.1 2.8.1.2] (inferred from 60% identity to fjo:Fjoh_2623)

Predicted SEED Role

"Thiosulfate sulfurtransferase, rhodanese (EC 2.8.1.1)" (EC 2.8.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9H6 at UniProt or InterPro

Protein Sequence (279 amino acids)

>CA265_RS18335 sulfurtransferase (Pedobacter sp. GW460-11-11-14-LB5)
MNSQSPIIKPAELTWLNQDDEIVIIDASAGSKARYDEQHLAGALFADVNNDLANIVDFAV
GGRHPLPTFGQFSAVLQRLGITKNSHVIVYDDKNGGNAAARLWWMLKAIGHKKVQVIDGG
FQAAVKAGFPTTDKIEIPKSVEQYEITAWNLPLSDINEVEKVAKTDDHIVIDVRDANRFA
GLTEPIDLIAGHIPGAANIPYTENLDASGAFLAPEILKEKYAEALAHVKPENVIVHCGSG
ITACHTLLAMDYAGLPIPKLYVGSWSEWSRNNKEMILAD