Protein Info for CA265_RS18110 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 TIGR00194: excinuclease ABC subunit C" amino acids 8 to 580 (573 residues), 505 bits, see alignment E=1.6e-155 PF01541: GIY-YIG" amino acids 17 to 94 (78 residues), 38.8 bits, see alignment E=1.4e-13 PF08459: UvrC_RNaseH_dom" amino acids 382 to 533 (152 residues), 175.3 bits, see alignment E=1.3e-55 PF14520: HHH_5" amino acids 548 to 590 (43 residues), 30.4 bits, see alignment 6.5e-11

Best Hits

Swiss-Prot: 59% identical to UVRC_FLAJ1: UvrABC system protein C (uvrC) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 85% identity to phe:Phep_0387)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z902 at UniProt or InterPro

Protein Sequence (600 amino acids)

>CA265_RS18110 excinuclease ABC subunit C (Pedobacter sp. GW460-11-11-14-LB5)
MSSFDHKTALTAIPHKPGVYQYWDADGKLMYIGKAKDLRNRVGSYFNSDRNQFNGKTRVL
VSKIRKITFTIVDTEIDAWLLENSLIKKHQPKFNINLKDDKTYPWIIVKNENYPRIYWTR
KVIKDGSTYFGPYGSIGMMHTILDLIKETYPLRTCTLPLTEKNIAEGKFKVCLEYQIGNC
KGPCQNYQTETDYDKNIGEIKEILNGKIGNVIRDVKGIIKSASENLNFELAHQYARRLEV
LEKYQSKSTVVNSAITNVDVVSIASDERYAFVNYLKVMNGTIIQTQTIEVKKQLDESDDE
ILTLAMLEFRTKFKSTSKEIIVPFEPSLEDESLKFTVPKLGEKKKLLELSQKNVLFFKKE
KLNQYEKLNPDLRTDRILTTMQKDLRLTQLPKHIECFDNSNFQGKYPVSAIVVFKDAKPS
KKDYRHFNVKTVEGPNDFATMEEAVFRRYRRMLDENQTLPQLIIIDGGKGQLSSAVKSLK
LLGIENKVTVIGIAKRLEELFYPGDSYPLYLDKKSETLKVIQQLRDEAHRFGITFHRKKR
DQGTLKTELEQIEGIGKTTADKLLTHFKSVKKIKEATEKELAEILNKKQVITLQAYFNQE