Protein Info for CA265_RS18040 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 5'-nucleotidase, lipoprotein e(P4) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF03767: Acid_phosphat_B" amino acids 17 to 228 (212 residues), 162.5 bits, see alignment E=5.8e-52 TIGR01533: 5'-nucleotidase, lipoprotein e(P4) family" amino acids 22 to 254 (233 residues), 287.8 bits, see alignment E=3.7e-90

Best Hits

Swiss-Prot: 37% identical to HEL_HAEIN: Lipoprotein E (hel) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 55% identity to shg:Sph21_5229)

MetaCyc: 37% identical to acid phosphomonoesterase (Haemophilus influenzae)
5'-nucleotidase. [EC: 3.1.3.5]; RXN-5822 [EC: 3.1.3.5, 3.1.3.108]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.108 or 3.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCP8 at UniProt or InterPro

Protein Sequence (254 amino acids)

>CA265_RS18040 5'-nucleotidase, lipoprotein e(P4) family (Pedobacter sp. GW460-11-11-14-LB5)
MRKYILIALLLAPFFVMAQNPARDYTNAVLWQQTSGEYRALCFQAYNFSRLSLKEALWAD
TSKKPNCVIVDIDETVLDNSAFQGHEIKKGLSYAPEDWTEWTNLAQADTVPGALAFLKFA
ASKHIETFYVSNRDEKDYNATLKNLQHFGFPYADDAHLIVSKGTSNKEPRRQKIKETHDI
LLLCGDNLSDFSNIFYRENKNTFAQVNANQNLFGTKYIVLPNPMYGDWEKPLYQGEKLND
QDKAKQRLERLKSY