Protein Info for CA265_RS18040 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 5'-nucleotidase, lipoprotein e(P4) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03767: Acid_phosphat_B
  • amino acids 17 to 228 (212 residues), 162.5 bits, E=5.8e-52
• TIGR01533: 5'-nucleotidase, lipoprotein e(P4) family
  • amino acids 22 to 254 (233 residues), 287.8 bits, E=3.7e-90

Best Hits

Swiss-Prot: 37% identical to HEL_HAEIN: Lipoprotein E (hel) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 55% identity to shg:Sph21_5229)

MetaCyc: 37% identical to acid phosphomonoesterase (Haemophilus influenzae)
5'-nucleotidase. [EC: 3.1.3.5]; RXN-5822 [EC: 3.1.3.5, 3.1.3.108]

Predicted SEED Role

No annotation

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (10/11 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (3/3 steps found)
• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation II (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD phosphorylation and dephosphorylation (2/3 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• ureide biosynthesis (4/7 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• NAD salvage (plants) (4/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.108 or 3.1.3.5

Sequence Analysis Tools

See A0A1X9ZCP8 at UniProt or InterPro

Protein Sequence (254 amino acids)

>CA265_RS18040 5'-nucleotidase, lipoprotein e(P4) family (Pedobacter sp. GW460-11-11-14-LB5)
MRKYILIALLLAPFFVMAQNPARDYTNAVLWQQTSGEYRALCFQAYNFSRLSLKEALWAD
TSKKPNCVIVDIDETVLDNSAFQGHEIKKGLSYAPEDWTEWTNLAQADTVPGALAFLKFA
ASKHIETFYVSNRDEKDYNATLKNLQHFGFPYADDAHLIVSKGTSNKEPRRQKIKETHDI
LLLCGDNLSDFSNIFYRENKNTFAQVNANQNLFGTKYIVLPNPMYGDWEKPLYQGEKLND
QDKAKQRLERLKSY