Protein Info for CA265_RS17095 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF13489: Methyltransf_23" amino acids 33 to 143 (111 residues), 60.3 bits, see alignment E=7e-20 PF01135: PCMT" amino acids 35 to 85 (51 residues), 20.4 bits, see alignment E=1.4e-07 PF02353: CMAS" amino acids 40 to 146 (107 residues), 28.9 bits, see alignment E=2.5e-10 PF13847: Methyltransf_31" amino acids 44 to 145 (102 residues), 47.6 bits, see alignment E=5.6e-16 PF13649: Methyltransf_25" amino acids 47 to 137 (91 residues), 66.3 bits, see alignment E=1.1e-21 PF08242: Methyltransf_12" amino acids 48 to 139 (92 residues), 47.3 bits, see alignment E=1e-15 PF08241: Methyltransf_11" amino acids 48 to 141 (94 residues), 56.6 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 56% identity to cpi:Cpin_1762)

Predicted SEED Role

"Methyltransferase type 11"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7N9 at UniProt or InterPro

Protein Sequence (203 amino acids)

>CA265_RS17095 SAM-dependent methyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MEKGERKNVYKVYNKIGKWFAENRYSFLGEKTYLDDLLKQLPPNASVLDLGCGSGKPILE
YLISQNVKVLGVDASEQMLEMARLNFPGTPFMLKDMRKLDLDEKFDAIIAWHSFFHLPAA
DQPGMFGIFSRHLKPNGVLLFTSGTGRGEVWGLNNGENLFHASLGIDEYLSLLKSNHFEV
LVHKINDPVCGGANVWMAQYKPR