Protein Info for CA265_RS17060 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 15 to 179 (165 residues), 183.4 bits, E=1.7e-58
• PF01583: APS_kinase
  • amino acids 17 to 170 (154 residues), 183.3 bits, E=4.7e-58
• PF13671: AAA_33
  • amino acids 20 to 133 (114 residues), 33.8 bits, E=5.8e-12
• PF13238: AAA_18
  • amino acids 21 to 139 (119 residues), 32.9 bits, E=1.3e-11

Best Hits

Swiss-Prot: 46% identical to CYSC_HALOH: Adenylyl-sulfate kinase (cysC) from Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 52% identity to mtt:Ftrac_2434)

MetaCyc: 41% identical to Met14 (Saccharomyces cerevisiae)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction IV (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

See A0A1X9Z7Q4 at UniProt or InterPro

Protein Sequence (191 amino acids)

>CA265_RS17060 adenylyl-sulfate kinase (Pedobacter sp. GW460-11-11-14-LB5)
MSLQTTAKNGFVIPDQKGIVVWLFGLSGSGKTTISTLLKEKLEEEGFFAITLDGDVLREG
INKDLGFSEADRAENIRRAAEIARLMMMNNVITICSFITPLEEHRALAAQIIGEQYFEVF
LDCPLAVCKERDVKGLYKDADRNLISNFTGVSARFEPALNAHLIIKTNTESPVQSRDKLF
LEIISKIKTQA