Protein Info for CA265_RS17060 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR00455: adenylyl-sulfate kinase" amino acids 15 to 179 (165 residues), 183.4 bits, see alignment E=1.7e-58 PF01583: APS_kinase" amino acids 17 to 170 (154 residues), 183.3 bits, see alignment E=4.7e-58 PF13671: AAA_33" amino acids 20 to 133 (114 residues), 33.8 bits, see alignment E=5.8e-12 PF13238: AAA_18" amino acids 21 to 139 (119 residues), 32.9 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 46% identical to CYSC_HALOH: Adenylyl-sulfate kinase (cysC) from Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 52% identity to mtt:Ftrac_2434)

MetaCyc: 41% identical to Met14 (Saccharomyces cerevisiae)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7Q4 at UniProt or InterPro

Protein Sequence (191 amino acids)

>CA265_RS17060 adenylyl-sulfate kinase (Pedobacter sp. GW460-11-11-14-LB5)
MSLQTTAKNGFVIPDQKGIVVWLFGLSGSGKTTISTLLKEKLEEEGFFAITLDGDVLREG
INKDLGFSEADRAENIRRAAEIARLMMMNNVITICSFITPLEEHRALAAQIIGEQYFEVF
LDCPLAVCKERDVKGLYKDADRNLISNFTGVSARFEPALNAHLIIKTNTESPVQSRDKLF
LEIISKIKTQA