Protein Info for CA265_RS16520 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sterol desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 257 to 282 (26 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 198 to 331 (134 residues), 99.4 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: None (inferred from 54% identity to cao:Celal_2688)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z8C9 at UniProt or InterPro

Protein Sequence (379 amino acids)

>CA265_RS16520 sterol desaturase (Pedobacter sp. GW460-11-11-14-LB5)
MSPNKRLVVGQGQISGYISIFLAVLALLGILCFHYPEKLTTPEFREIYTKNSMEALMLGG
VIAAFFFSLLSLILSKKLKWAWPGFVLGALAVILGALSVEGRDVAKSSWHFGLDWMILDL
LLMVAIFVPLELFFPKNNEQTKFHEEWRTDLTYFVISHLFIQFFGIVTQKPAVLFFGWIG
LDKLHTWVQGLPFIVALFLAFFSTDLFQYWAHRFFHTRVALWRFHSIHHSTQNMDWLAGS
RTHFIDIFFTRAMTFIPLYVLGFSSTVFNVYIIFIAIHAVLIHANTRINFGPLKYIFTTP
QYHHWHHCEDPKYYGHNFASIFPFIDMMFGTYYLPGKEWPAGTGVHEASYPKGFVKQSIY
PFTKSPFDTDLNMEERSDR