Protein Info for CA265_RS16185 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 248 to 272 (25 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 19 to 277 (259 residues), 96.7 bits, see alignment E=1e-31 PF03631: Virul_fac_BrkB" amino acids 24 to 280 (257 residues), 170.9 bits, see alignment E=2.1e-54

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 65% identity to shg:Sph21_2110)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7A1 at UniProt or InterPro

Protein Sequence (322 amino acids)

>CA265_RS16185 ribonuclease BN (Pedobacter sp. GW460-11-11-14-LB5)
MAKSKVTLKGIWGILKASFTGFNNHKVTKLSGSLAYYTVFSMAPLLVVIISLCGIFLGRE
IAEGQVYAQLEGFLGRESAISLQQLIKNAYLDGKSTIALIVGIITLLIGATTVFGDIQDS
INTIWGLKPKPKRGWVKLLQNRFLSFSVIISLGFVLLVSLAVTSVLDAFSNRLQARFAEI
SVIVFYILNQVVTLAVISLIFGVIFKVLPDAIIKWRDVIAGAIVTAVLFMIGKFAISIYI
GQSNVGGTYGATGSLVVVLLWTYYSSIILYFGAEFTKAYAVAFGSEIYPSHYAVTTKEIE
IETEGKSIQDNHPEIKKEVKKA