Protein Info for CA265_RS16150 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: UDP-diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 6 to 247 (242 residues), 228.9 bits, see alignment E=4.1e-72 PF02673: BacA" amino acids 6 to 250 (245 residues), 273.9 bits, see alignment E=8.1e-86

Best Hits

Swiss-Prot: 71% identical to UPPP_FLAPJ: Undecaprenyl-diphosphatase (uppP) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 73% identity to psn:Pedsa_0245)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z808 at UniProt or InterPro

Protein Sequence (264 amino acids)

>CA265_RS16150 UDP-diphosphatase (Pedobacter sp. GW460-11-11-14-LB5)
MNSFEAIVLAIVEGLTEFLPVSSTGHMIIASSFMGIASEPFVKLFTIAIQLGAILSVLVL
YFKRFFKSINFYIKLIVAFIPAAIFGLLLSKKIDELLESPMAVGISLLVGGIILLFVDKW
FNKPTINEEEEVTYLTALKIGFFQCIAMIPGVSRSGATIVGGMSQKLSRKVAAEFSFFLA
VPTMFAATAKKLYDFYKEGHTITHEQTNLLIIGNVVAFIVALLAIKSFIGYLNKNGFKVF
GWYRIAAGLIIIILLLSGHNLQII