Protein Info for CA265_RS16075 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): Cytidine deaminase (EC 3.5.4.5)
Rationale: Specifically important for utilizing Cytidine. Automated validation from mutant phenotype: the predicted function (CYTIDEAM2-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08211: dCMP_cyt_deam_2
  • amino acids 8 to 82 (75 residues), 33.9 bits, E=3.4e-12
• PF00383: dCMP_cyt_deam_1
  • amino acids 23 to 124 (102 residues), 34.5 bits, E=1.6e-12

Best Hits

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 46% identity to cao:Celal_0749)

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• pyrimidine deoxyribonucleosides degradation (3/3 steps found)
• pyrimidine ribonucleosides salvage I (3/3 steps found)
• pyrimidine ribonucleosides degradation (2/2 steps found)
• pyrimidine deoxyribonucleosides salvage (4/5 steps found)
• pyrimidine ribonucleosides salvage II (1/2 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (3/6 steps found)
• superpathway of pyrimidine ribonucleosides degradation (2/5 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

See A0A1X9Z850 at UniProt or InterPro

Protein Sequence (162 amino acids)

>CA265_RS16075 Cytidine deaminase (EC 3.5.4.5) (Pedobacter sp. GW460-11-11-14-LB5)
MNSINLNISFEQYESIAELTLADRTLCALAEQALNTSYSPYSKFRVGTAIRLASGETVLG
SNQENLAYPSGLCAERVALFTIGATYPNAVIESMAITAQTDNFEILKPVTSCGGCLQVMA
EFERKQNAPIEVIFYCLNGEILKVPSVKSLLPFAFVEDRLER