Protein Info for CA265_RS16035 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF10672: Methyltrans_SAM" amino acids 59 to 247 (189 residues), 40.1 bits, see alignment E=2.5e-14 PF03602: Cons_hypoth95" amino acids 124 to 204 (81 residues), 26.1 bits, see alignment E=6.2e-10

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 86% identity to phe:Phep_3463)

Predicted SEED Role

"possible oxidoreductase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7X7 at UniProt or InterPro

Protein Sequence (293 amino acids)

>CA265_RS16035 oxidoreductase (Pedobacter sp. GW460-11-11-14-LB5)
MIQLLAPTHWKDYELIDCGDFEKLERFGNVTLIRPEPQAVWKKTYSEQDWKKAANITFRG
RSATSGEWVKKNQSIPDRWHVEYKNNEVGIKLRLGLTSFKHVGVFPEQAVNWDFISASIK
KFKTPQPKVLNLFAYTGAASLIANAAGAETTHVDSIKQVVTWANENQELSGLKDTRWMVE
DALKFVKKELKRGKKYNGIILDPPAYGHGPNGEKWKLEDHIQEMMQDVVQLLDEKEHFLI
LNTYSLGFSSVIVENLIRTSFPSVKNLETGELFLQATSGIKLPLGVFGKFCNV