Protein Info for CA265_RS15965 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01035: glutamyl-tRNA reductase" amino acids 6 to 402 (397 residues), 255 bits, see alignment E=6.4e-80 PF05201: GlutR_N" amino acids 7 to 160 (154 residues), 116.3 bits, see alignment E=1.6e-37 PF01488: Shikimate_DH" amino acids 181 to 308 (128 residues), 97.9 bits, see alignment E=8.4e-32 PF00745: GlutR_dimer" amino acids 323 to 403 (81 residues), 24 bits, see alignment E=6.1e-09

Best Hits

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 76% identity to phe:Phep_3451)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7E0 at UniProt or InterPro

Protein Sequence (408 amino acids)

>CA265_RS15965 glutamyl-tRNA reductase (Pedobacter sp. GW460-11-11-14-LB5)
MEYLKVIAFTHHHIDLKSLGKLVICDQSLDSRLKNVQAELPVSEIFYIGTCNRVEFVFLT
KEKTDKEFVTRFLTVLDMGLPPEFMERFLDNVSVYENEEAFNHLLRTSCSLESLVVGEKE
ILAQIRKAYENCRDAGFTGDYMRMIMDRVVKTAKEVYTHTNISKNPVSVVSLAYRKLKEL
NMCGNSRILIIGAGETNQNIAKYLNKHKYSNFSIFNRTFSKAEALAGELGGKAYPLAALE
DFNEGFDVIITCTGSTEAIITEALYAKLLNGDQGKKVIVDLAIPNDVTPAVIHNNPVHYI
EVESLKEVARKNIQERYNELVHAEEIISNNITEFFSVLKQRRIELAMQEVPRKIKEIKNT
AINGVFADEISQMDEASREVLERVMNYMEKKYISVPMVMAKEILVNQS