Protein Info for CA265_RS15740 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: adenylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF00406: ADK" amino acids 6 to 164 (159 residues), 169.4 bits, see alignment E=6.1e-54 PF13207: AAA_17" amino acids 7 to 143 (137 residues), 107 bits, see alignment E=9.8e-35

Best Hits

Swiss-Prot: 53% identical to KAD_FLAPJ: Adenylate kinase (adk) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 76% identity to phe:Phep_3381)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6Z8 at UniProt or InterPro

Protein Sequence (191 amino acids)

>CA265_RS15740 adenylate kinase (Pedobacter sp. GW460-11-11-14-LB5)
MLNLVLFGPPGAGKGTQSEKLITKYQLVHVSTGDLFRAHVKGETELGKKVSQLLADGELV
PDAITIAMLEEEVDKNPDAKGFVFDGFPRTVPQAIELDLFLERKGSKIAGVIALDVDQDE
LTKRIAERHKTSGRPDDDAEKLKKRISEYFDKTIHVLPYYEEQGKLNKVNGIGEIETVYN
DLCAVIDQYKV