Protein Info for CA265_RS15700 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details PF00672: HAMP" amino acids 173 to 219 (47 residues), 33.7 bits, see alignment 7.3e-12 TIGR00229: PAS domain S-box protein" amino acids 232 to 287 (56 residues), 24.4 bits, see alignment 1.3e-09 PF00989: PAS" amino acids 235 to 288 (54 residues), 34.6 bits, see alignment 3.3e-12 PF00512: HisKA" amino acids 358 to 426 (69 residues), 67.4 bits, see alignment E=1.9e-22 PF02518: HATPase_c" amino acids 479 to 581 (103 residues), 73.6 bits, see alignment E=3.6e-24

Best Hits

KEGG orthology group: None (inferred from 64% identity to phe:Phep_2503)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z792 at UniProt or InterPro

Protein Sequence (583 amino acids)

>CA265_RS15700 PAS domain-containing sensor histidine kinase (Pedobacter sp. GW460-11-11-14-LB5)
MKIKTKLRLGFGFLFIIVLSFGLIALFYLNELSDKSKVILKDNYKSLKYVAAMRNVIDQH
PFPLNSTQQAIFTENLKNEGLNITEPGEKAAFQKLEIAFNVLNDSKSSAIKANSIKDLRV
ALQNIEQVNMKAIYDKNELANEASSRANLYIMIAATLSFIILFTFIVNFPGFVANPLAEF
SAAIKQISRKNYKQRLHFENDDEFTELADSFNGMVVKLNEWENSNLSKIKSEKSRIEAII
AQMQDAIIGLNEKGEVLFLNHLAAKLMSLDEDKVIGQNVAELMQKNELLKRIIKPETNDN
TLKIYADDKESYFLLENREIIIPNYEEQDENTLIASSKSAGSVYTLKNITQFKELDEAKT
NFIATVSHELKTPLSSIKMSLKLLNDERVGGMNDEQHELLNHIQEDSDRLLKITSELLDL
SQVETGNLKLTFAITKPEEIVQYAIDAVKFQAEQKSIELVLNCDQNLPNVNADIQKTAWV
MVNFLSNALRYSSEKSKVIIDIFQKDKFIEFSVRDFGKGIDEKYQKRLFDRYFQVPTDGQ
NKSGSGLGLAISKDFIEAENGKIWVVSAIGEGSKFCFSLPVVE