Protein Info for CA265_RS15575 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: antibiotic ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 153 to 179 (27 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 30 to 299 (270 residues), 164.1 bits, see alignment E=5.6e-52 PF00005: ABC_tran" amino acids 361 to 510 (150 residues), 95.5 bits, see alignment E=4.7e-31

Best Hits

Swiss-Prot: 36% identical to YKNU_BACSU: Uncharacterized ABC transporter ATP-binding protein YknU (yknU) from Bacillus subtilis (strain 168)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 79% identity to phe:Phep_0669)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6W2 at UniProt or InterPro

Protein Sequence (589 amino acids)

>CA265_RS15575 antibiotic ABC transporter ATP-binding protein (Pedobacter sp. GW460-11-11-14-LB5)
MAVTGDVYNTGLLKRIFQYVKPYRAVFVWSVILTILLAAISPVRPFLIKYTLDHYILAGN
YSGLVNMTMLMVFMLILQTLIQYNHTLLTNTLGQSVIRDLRINVFNHITKLRLKFFDKTP
IGQLITRTVSDLETIADIFSEGLISMIGDSLQVVVIVCVMLYTDWQLSLVVLLPIPLLIM
ATRKFQQAIKVAFQEIRNEVSNLNTFLQEHITGVSIVQYFAREKQEYRKFYAINKRYRDA
NIRSNWYYSIFFPVVELISAMSLGLLVWYGAKSILSKPLDVTPGTITQFIMYLGMVFTPI
RQLADKFNTLQMGMVGAERVFKVLDTDETTPNEGTQRPAKLEGNIKFEKVWFAYNDENYV
LKDLSFEVKAGETVALVGATGAGKSSTINILNRFYEVKKGDITVDGIRIEDFDLDYLRSH
IATVLQDVFLFSDTILNNITLNNPEITIAEVVNAAKKVGAHDFIERLPGAYQYNVMERGA
TLSAGQAQLISFIRALVHNPAILVLDEATSSVDTETELLIQKAIDNLMEGRTSIVIAHRL
STIQKADQIIVLDKGEIKEKGTHQQLLKLNGYYKKLYDLQFSSKGIAKV