Protein Info for CA265_RS15515 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: NmrA family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF05368: NmrA" amino acids 3 to 183 (181 residues), 38.3 bits, see alignment E=1.6e-13 PF01370: Epimerase" amino acids 3 to 51 (49 residues), 23.2 bits, see alignment 6.5e-09 PF13460: NAD_binding_10" amino acids 7 to 173 (167 residues), 48.2 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: None (inferred from 57% identity to agr:AGROH133_15318)

Predicted SEED Role

"putative secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7Y8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>CA265_RS15515 NmrA family transcriptional regulator (Pedobacter sp. GW460-11-11-14-LB5)
MKIVVIGGTGLIGNQIVNQLQNSGHEVIAASPNKGVNTLTGEGLKEVLQGAQVVIDVSNS
PSFEDTAVMNFFKTSNENLLPMAKAAGVQHHIALSVVGTQKLQASGYFRAKQVQEDLIKA
SGIPYTLVHATQFFEFAGGIVQMSITDGKVILPAANIQPIASKDVAAFMAKIALEKPANQ
ILEIGGPEKYDMAIWIRQYLQATHQNDEVTSDVEAPYSGALLTADTLVPEAAVFLGETHY
TDWIAITKNQR