Protein Info for CA265_RS15425 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: phosphopyruvate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03952: Enolase_N
  • amino acids 4 to 134 (131 residues), 209.6 bits, E=1.6e-66
• TIGR01060: phosphopyruvate hydratase
  • amino acids 4 to 426 (423 residues), 685.1 bits, E=1.5e-210
• PF00113: Enolase_C
  • amino acids 141 to 428 (288 residues), 430.8 bits, E=2.8e-133

Best Hits

Swiss-Prot: 78% identical to ENO_GRAFK: Enolase (eno) from Gramella forsetii (strain KT0803)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 88% identity to psn:Pedsa_2466)

MetaCyc: 70% identical to enolase subunit (Streptococcus mutans)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• gluconeogenesis I (12/13 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• homolactic fermentation (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• Entner-Doudoroff pathway I (7/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• heterolactic fermentation (13/18 steps found)
• gallate biosynthesis (2/3 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• quinate degradation I (1/3 steps found)
• quinate degradation II (1/3 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)
• glycerol degradation to butanol (9/16 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (15/26 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• superpathway of chorismate metabolism (35/59 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (4/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (6/42 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.11

Sequence Analysis Tools

See A0A1X9Z6T9 at UniProt or InterPro

Protein Sequence (431 amino acids)

>CA265_RS15425 phosphopyruvate hydratase (Pedobacter sp. GW460-11-11-14-LB5)
MSIIVNVHARQILDSRGNPTVEVEVVTEAGAFGRAAVPSGASTGQYEAVELRDGDKSTYL
GKGVLKAVENVNTKIADALRGIDVFEQNTIDKIMLDLDGTENKGNLGANAILGVSLAVAK
AAADEIGQPLYRYIGGVNANTLPIPMMNIINGGSHSDAPIAFQEFMIMPVGAPSFSEALR
WGTEVFHSLKKILHDRGLSTAVGDEGGFAPTFDGTEDAIETVLKAIETAGYKPGSQICLA
LDCASSEFYKDGKYDYTKFEGATGVIRSSEEQAQYLADLSAKYPIISIEDGMDENDWTGW
KSLTDKIGDHVQLVGDDLFVTNVTRLQRGIDEDTANSILVKVNQIGSLTETINAVTLAQN
SGYTSVMSHRSGETEDVTIADLAVALNCGQIKTGSASRSDRIAKYNQLLRIEEELGENAR
FIGSKFKYAKK