Protein Info for CA265_RS15275 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: phenylalanine--tRNA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF02912: Phe_tRNA-synt_N" amino acids 20 to 84 (65 residues), 58.3 bits, see alignment E=6.1e-20 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 39 to 342 (304 residues), 320.3 bits, see alignment E=7.2e-100 PF01409: tRNA-synt_2d" amino acids 91 to 341 (251 residues), 326.5 bits, see alignment E=1.1e-101

Best Hits

Swiss-Prot: 64% identical to SYFA_PARD8: Phenylalanine--tRNA ligase alpha subunit (pheS) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 86% identity to phe:Phep_3627)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6R1 at UniProt or InterPro

Protein Sequence (346 amino acids)

>CA265_RS15275 phenylalanine--tRNA ligase subunit alpha (Pedobacter sp. GW460-11-11-14-LB5)
MLQDKITQYTDKINAFVTEKADELEQFRIKYLGSKGIIKEIFDEFKSVSVEEKRSLGKVL
NEFKQLAESKYLTLKESTENAEAKTESIQQDLTLPGEGFEIGSRHPLALVRREIVEIFAK
LGFTVAEGPEIEDDWHNFSALNFPEEHPARDMQDTFFIKKGGEKGDIALRTHTSSVQVRM
MEQGQPPFRAIMPGRVYRNEAISARAHCFFHQVEGLYVDENVSFADLKQTLFYFVQELYG
EGTKVRFRPSYFPFTEPSAEMDISCTICKGSGCQLCKYSGWVEILGCGMVDPNVLENCGI
DSEKYSGFAFGMGIERIANLKYVIKDLRLFSENDARFLKQFKSALI