Protein Info for CA265_RS15175 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: thioredoxin-dependent thiol peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF08534: Redoxin" amino acids 5 to 147 (143 residues), 106.2 bits, see alignment E=1.4e-34 PF00578: AhpC-TSA" amino acids 7 to 134 (128 residues), 156.7 bits, see alignment E=2.7e-50

Best Hits

Swiss-Prot: 51% identical to BCP_COXBU: Putative peroxiredoxin bcp (bcp) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 81% identity to phe:Phep_0880)

MetaCyc: 45% identical to thiol peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Bcp-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7L5 at UniProt or InterPro

Protein Sequence (154 amino acids)

>CA265_RS15175 thioredoxin-dependent thiol peroxidase (Pedobacter sp. GW460-11-11-14-LB5)
MAELKEGDQAPAITSKDQNGTEVSLSDYKGKTVVLYFYPKDDTPGCTAEACDFRDNYQGL
QAKGIVVLGVSVDDEKSHQKFVTKHNLPFTLLADTDQKIVNDYGVWAEKNMYGKKYMGTV
RTTFIIDGDGKITHIIKKVDTKNSTQQVLDLINN