Protein Info for CA265_RS15100 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 48 to 69 (22 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 21 to 115 (95 residues), 43.7 bits, see alignment E=4.1e-15 amino acids 182 to 237 (56 residues), 28.7 bits, see alignment E=1.6e-10 PF12697: Abhydrolase_6" amino acids 22 to 242 (221 residues), 50.4 bits, see alignment E=7.3e-17

Best Hits

KEGG orthology group: None (inferred from 83% identity to phe:Phep_0981)

Predicted SEED Role

"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6R2 at UniProt or InterPro

Protein Sequence (254 amino acids)

>CA265_RS15100 alpha/beta hydrolase (Pedobacter sp. GW460-11-11-14-LB5)
MTYPIIEEDGFKYIEAGTGETLVLLHGLMGELSNWELVIEQFKDRYRVIIPILPIYDLPI
LTLGVKALSRYLHRFLKYKNLNQVVLVGNSLGGHVGLVFTVAHQEFVKALVLTGSSGLYE
NAFGGSFPRRESYDYIKEKVEFTFYDPATATKELVDDVFKTVNDRSRVIRILTMAKSAIR
HNMAKELSKITIPVSLIWGKNDKVTPPEVAEEFHELLPNSELNWVDKCGHAPMMEHPQIF
NAFLEKFLDRILLK