Protein Info for CA265_RS15010 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details PF01914: MarC" amino acids 6 to 182 (177 residues), 112.7 bits, see alignment E=8.4e-37

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 87% identity to phe:Phep_0996)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCK1 at UniProt or InterPro

Protein Sequence (188 amino acids)

>CA265_RS15010 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MTFNLSQILSTTMVLFAIIDILGAIPVVIELRRKAGHIESEKASLVAAGLMILFLFVGES
LLKVIGLDVESFAIAGSFVIFFIAMEMVLGLTIFKEEAPETVSIVPLAFPLIAGAGTMTT
LLSLKTEYHTQNILVGIILNMLFVYFVLKNTNRLEKLFGKSGLNILRKAFGVILLAIAIK
LFRNNTGL