Protein Info for CA265_RS14945 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF04851: ResIII" amino acids 14 to 140 (127 residues), 33.3 bits, see alignment E=9e-12 PF00270: DEAD" amino acids 16 to 172 (157 residues), 132.7 bits, see alignment E=2.3e-42 PF00271: Helicase_C" amino acids 212 to 319 (108 residues), 99.3 bits, see alignment E=3.2e-32 PF03880: DbpA" amino acids 361 to 431 (71 residues), 69.8 bits, see alignment E=3.4e-23

Best Hits

KEGG orthology group: K05591, ATP-independent RNA helicase DbpA [EC: 3.6.4.13] (inferred from 68% identity to phe:Phep_1011)

Predicted SEED Role

"ATP-dependent RNA helicase"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6I9 at UniProt or InterPro

Protein Sequence (434 amino acids)

>CA265_RS14945 helicase (Pedobacter sp. GW460-11-11-14-LB5)
MIENALKKLNIAALNEMQESSVKAAKTGKDVILIAPTGSGKTLAFLLPLLSNLKAGVKGV
QALVLVPSRELALQIEQVFKQMGTSFKVNCCYGGHAVRIEKNNLAHPPAVLIGTPGRIAY
HLEYQNFDESFIETLVLDEFDKALEFGFENDMSYIIGSLLSLKQRILTSATKMEEIPAFV
KLNSPVEVDFSKNIEAKPDLKLKKITAPAADKLDYLFRLLSKIGSKNTLVFCNHRETVDR
ISDLLFENGLGHDVFHGGMEQFDREKALLKFRNGSHRILITTDLAARGLDIPEVEHIVHY
QLPYTEDAYIHRNGRTARMHAKGTAYAILTTEEHYKYLPDDIEEEVLSEQYKLPEASDWV
TLYLAHGKKDKINKIDIVGLFLQKGTLTKEDLGLIEVKDTTSYIAVKRNKVEKLLKTLSG
EKIKGKKLKLEVAS