Protein Info for CA265_RS14410 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 4-amino-4-deoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00826, branched-chain amino acid aminotransferase [EC: 2.6.1.42] (inferred from 70% identity to phe:Phep_1220)

Predicted SEED Role

"Aminodeoxychorismate lyase (EC 4.1.3.38)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 4.1.3.38)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
L-leucine biosynthesis (6/6 steps found)
superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
L-valine biosynthesis (4/4 steps found)
superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
4-aminobenzoate biosynthesis I (2/2 steps found)
L-isoleucine biosynthesis II (6/8 steps found)
L-isoleucine biosynthesis V (2/3 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-valine degradation II (2/3 steps found)
L-isoleucine biosynthesis IV (4/6 steps found)
L-isoleucine degradation I (4/6 steps found)
L-leucine degradation I (4/6 steps found)
anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
4-aminobenzoate biosynthesis II (1/2 steps found)
L-alanine biosynthesis I (1/2 steps found)
superpathway of L-alanine biosynthesis (2/4 steps found)
superpathway of L-threonine metabolism (12/18 steps found)
L-isoleucine biosynthesis III (4/7 steps found)
L-isoleucine degradation III (oxidative Stickland reaction) (1/3 steps found)
L-leucine degradation V (oxidative Stickland reaction) (1/3 steps found)
L-valine degradation III (oxidative Stickland reaction) (1/3 steps found)
L-leucine degradation IV (reductive Stickland reaction) (2/5 steps found)
L-valine degradation I (3/8 steps found)
superpathway of candicidin biosynthesis (4/11 steps found)
superpathway of chorismate metabolism (35/59 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.42

Use Curated BLAST to search for 2.6.1.42 or 4.1.3.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7C9 at UniProt or InterPro

Protein Sequence (279 amino acids)

>CA265_RS14410 4-amino-4-deoxychorismate lyase (Pedobacter sp. GW460-11-11-14-LB5)
MLQEYLLFNDEFQAVDAPILTASNRSFKFGDGLFESMRMINNKLQFADLHADRLTAGMKA
LKIDGHALMDDYFLRQKTADLAKRNKWNGNVRFRLSVYRGGAGVYTPEINKAGYILEGIP
LKASTYELNSKGLIIDVFDEMTKPVNKLSNFKTANALLYVMAGLFKSQNRLDEAMILNQY
GFLCESISANVFVVYNKQIYTPSLAEGCISGVMRTAIMQLCKMHDMPLIEAQINPEILKE
AEEVFITNATQGIQWVMGYGRKRYFNEISKFLIEKLNHL